Germany
Japan
United Kingdom
China
Immunology
View as table Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal antibody to beta Actin (actin, beta)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Dog, Rabbit, Chicken, Sheep, Chimpanzee, Bovine, Guinea Pig, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin |
Rabbit Polyclonal Anti-ACTIN Antibody
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of Arabidopsis thaliana actin |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal Anti-Actin-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-Beta actin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Beta actin antibody: A synthesized peptide derived from human Beta actin |
Active filters
Target Symbol
- BETA ACTIN
Clonalities
- Polyclonal
Pathways
- Tight junction