Rabbit Polyclonal Anti-AIM2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AIM2 |
Rabbit Polyclonal Anti-AIM2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AIM2 |
Rabbit polyclonal anti-AIM2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AIM2. |
Rabbit polyclonal anti-CSRL1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CSRL1. |
AIM2 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the C-Terminus of the protein sequence according to NP_004824.1. |
AIM2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 11~40 amino acids from the N-terminal region of human AIM2 |
AIM2 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human AIM2 (NP_004824.1). |
Modifications | Unmodified |
Mouse Monoclonal AIM2 Antibody (10M5G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal AIM2 Antibody (10M2B3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal AIM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-AIM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DKQYKSVTKPKPLSQ, from the internal region of the protein sequence according to NP_004824.1. |
Rabbit Polyclonal Anti-AIM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AIM2 antibody: synthetic peptide directed towards the N terminal of human AIM2. Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL |
AIM2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human AIM2 |