Germany
Japan
United Kingdom
China
Innate Immunity
View as table Download
Rabbit polyclonal anti-AIM2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AIM2. |
Mouse monoclonal AIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-AIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKQYKSVTKPKPLSQ, from the internal region of the protein sequence according to NP_004824.1. |
Rabbit Polyclonal Anti-AIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AIM2 antibody: synthetic peptide directed towards the N terminal of human AIM2. Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL |
AIM2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human AIM2 |
Active filters
Target Symbol
- AIM2
Conjugates
- Unconjugated