Adaptive Immunity

Jump to Filters
View as table Download
PDHA2 (Center) Rabbit Polyclonal Antibody
AP53242PU-N

USD 580.00

2 Weeks

PDHA2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 290-318 amino acids from the Central region of Human PDHA2
PDHA2 Rabbit Polyclonal Antibody
TA335716

USD 539.00

5 Days

Rabbit Polyclonal Anti-PDHA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDHA2 Antibody: synthetic peptide directed towards the N terminal of human PDHA2. Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG