Germany
Japan
United Kingdom
China
Mouse monoclonal anti-HSP90AB1(HSP90) antibody, clone 4C10, Load, clone OTI4C10 (formerly 4C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Dog, Monkey |
| Conjugation | Unconjugated |
Adaptive Immunity
View as table Download
Mouse monoclonal anti-HSP90AB1(HSP90) antibody, clone 4C10, Load, clone OTI4C10 (formerly 4C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Dog, Monkey |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Carrier-free (BSA/glycerol-free) HSP90AB1 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Dog, Monkey |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3 |
Rabbit polyclonal HSP90B (Ab-254) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal HSP90AB1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 697-724 amino acids from the C-terminal region of human HSP90AB1. |
Rabbit polyclonal HSP90AB1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 438-465 amino acids from the Central region of human HSP90AB1. |
HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Conjugates
- Unconjugated
Families
- Stem cell - Pluripotency
Pathways
- Antigen processing and presentation