Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | ChIP, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Rabbit Polyclonal Antibody against RPS6KB1 (Center)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This S6K (RPS6KB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-306 amino acids from the Central region of human S6K (RPS6KB1). |
Rabbit polyclonal antibody to RAB2A (RAB2A, member RAS oncogene family)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Dog, Rabbit, Chicken, Chimpanzee, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 148 and 212 of RAB2A (Uniprot ID#P61019) |
Rabbit Polyclonal Antibody against RPS6KB1 (S424)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This S6K (RPS6KB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 425-454 amino acids from human S6K (RPS6KB1). |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Goat Anti-IGF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSVRAQRHTD, from the internal region of the protein sequence according to NP_001104753.1; NP_001104754.1; NP_001104755.1; NP_000609.1. |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Rabbit, Pig, Canine, Chicken, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit Polyclonal Antibody against MAP2K1 (T291)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Hamster, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This MAP2K1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 270-299 amino acids from human MAP2K1. |
VEGFD (C-term) rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against RPS6KB1 (S404)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This S6K (RPS6KB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 405-434 amino acids from human S6K (RPS6KB1). |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Chicken, Drosophila, Hamster, Rabbit, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Germany
Japan
United Kingdom
China
