alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) alpha-actinin mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 509.00
2 Weeks
alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
LEF1 mouse monoclonal antibody,clone OTI10A7, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Biotin |
LEF1 mouse monoclonal antibody,clone OTI10A7, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | HRP |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
Applications | IHC, WB |
Reactivities | Human (Predicted: Dog, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Anti-ACTN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1 |
Rabbit Polyclonal Anti-ACTN4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACTN4 |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |