Germinal Center B cell

cDNA Clones (38)
Proteins (21)
RNAi (12)
Gene Expression (7)
Antibodies (6)
Jump to Filters
View as table Download
Cd83 (NM_009856) Mouse Tagged ORF Clone Lentiviral Particle
MR219448L3V

USD 850.00

2 Weeks

Lenti ORF particles, Cd83 (Myc-DDK-tagged) - Mouse CD83 antigen (Cd83), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CD83 Rabbit Polyclonal Antibody
TA365606

USD 380.00

4 Weeks

CD83 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CD83
CD83 (NM_001040280) Human Over-expression Lysate
LC421736

USD 134.00

In Stock

CD83 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CD83 (NM_001040280) Human Over-expression Lysate
LY421736

USD 436.00

In Stock

Transient overexpression lysate of CD83 molecule (CD83), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
CD83 (NM_004233) Human Tagged Lenti ORF Clone
RC205302L4

USD 600.00

3 Weeks

Lenti ORF clone of Human CD83 molecule (CD83), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD83 (NM_001040280) Human Tagged Lenti ORF Clone
RC212520L4

USD 600.00

3 Weeks

Lenti ORF clone of Human CD83 molecule (CD83), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd83 (NM_009856) Mouse Tagged ORF Clone Lentiviral Particle
MR219448L4V

USD 850.00

7 Weeks

Lenti ORF particles, Cd83 (GFP-tagged) - Mouse CD83 antigen (Cd83), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CD83 (NM_004233) Human Tagged Lenti ORF Clone
RC205302L3

USD 600.00

In Stock

Lenti ORF clone of Human CD83 molecule (CD83), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd83 (NM_001108410) Rat Tagged ORF Clone Lentiviral Particle
RR204497L3V

USD 880.00

11 Weeks

Lenti ORF particles, Cd83 (Myc-DDK-tagged ORF) - Rat CD83 molecule (Cd83), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Cd83 (NM_001108410) Rat Tagged ORF Clone Lentiviral Particle
RR204497L4V

USD 880.00

11 Weeks

Lenti ORF particles, Cd83 (GFP-tagged ORF) - Rat CD83 molecule (Cd83), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Human CD83 activation kit by CRISPRa
GA106201

USD 1,657.00

2 Weeks

CD83 CRISPRa kit - CRISPR gene activation of human CD83 molecule

Format 3 gRNAs (5ug each), 1 scramble ctrl (10ug) and 1 enhancer vector (10ug)
CD83 Rabbit Polyclonal Antibody
TA343115

USD 539.00

5 Days

Rabbit Polyclonal Anti-CD83 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD83 antibody is: synthetic peptide directed towards the C-terminal region of Human CD83. Synthetic peptide located within the following region: GTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALV
CD83 Rabbit Polyclonal Antibody
TA347927

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CD83 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD83 Antibody: A synthesized peptide derived from human CD83
CD83 Rabbit Polyclonal Antibody
TA374488

USD 365.00

3 Weeks

CD83 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-144 of human CD83 (NP_004224.1).
Modifications Unmodified
CD83 (NM_001040280) Human Recombinant Protein
TP720345

USD 330.00

7 Weeks

Recombinant protein of human CD83 molecule (CD83), transcript variant 2

Tag C-His
Expression Host HEK293