Assay Kits

View as table Download

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

MYC biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600496

MYC biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600497

Rabbit Polyclonal cIAP2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal eNOS Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

AKT2 mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700009

AKT2 biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600009

BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified

Applications ELISA, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified

Applications ELISA, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Laminin alpha 5 (LAMA5) mouse monoclonal antibody, clone 4B12, Purified

Applications ELISA, IF, IHC, IP
Reactivities Human
Conjugation Unconjugated

Collagen IV (COL4A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Conjugation Unconjugated
Immunogen Collagen Type IV from Human and Bovine placenta.

Rabbit Polyclonal Integrin alpha 6 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal Cyclin E2 Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal LAMC2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.