Rabbit Polyclonal Anti-ZNF772 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF772 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF772. Synthetic peptide located within the following region: LAEHQETHPGQKPYMCVLCGKQFCFSANLHQHQKQHSGEKPFRSDKSRPF |
Rabbit Polyclonal Anti-ZNF772 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF772 antibody is: synthetic peptide directed towards the middle region of Human ZNF772. Synthetic peptide located within the following region: SFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCGKRHYKCSE |
Rabbit Polyclonal Anti-ZNF772 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF772 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF772. Synthetic peptide located within the following region: DVFVYFSQEEWVLLDEAQRLLYRDVMLENFALMASLGHTSFMSHIVASLV |
Germany
Japan
United Kingdom
China