Antibodies

Jump to Filters
View as table Download
HES5 Rabbit Polyclonal Antibody
TA349126

USD 570.00

5 Days

Rabbit Polyclonal Anti-HES5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HES5 antibody was raised against a 19 amino acid peptide near the amino terminus of human HES5.
HES5 Rabbit Polyclonal Antibody
TA351244

USD 380.00

In Stock

Rabbit Polyclonal Anti-HES5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HES5
HES5 Rabbit Polyclonal Antibody
TA342132

USD 539.00

5 Days

Rabbit Polyclonal Anti-HES5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HES5 antibody: synthetic peptide directed towards the middle region of human HES5. Synthetic peptide located within the following region: AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH
HES5 Rabbit Polyclonal Antibody
TA377002

USD 365.00

3 Weeks

HES5 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic Peptide of human HES5
Modifications Unmodified