HES5 Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HES5 antibody: synthetic peptide directed towards the middle region of human HES5. Synthetic peptide located within the following region: AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 18 kDa |
Gene Name | hes family bHLH transcription factor 5 |
Database Link | |
Background | This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors.The protein product ofThis gene, which is activated downstream ofThe Notch pathway, regulates cell differentiation in multiple tissues. Disruptions inThe normal expression ofThis gene have been associated with developmental diseases and cancer. |
Synonyms | bHLHb38 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Bovine: 93%; Mouse: 88%; Pig: 85%; Guinea pig: 85% |
Reference Data | |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Protein Pathways | Notch signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review