GALNT10 mouse monoclonal antibody,clone OTI2A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GALNT10 mouse monoclonal antibody,clone OTI2A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GALNT10 mouse monoclonal antibody,clone OTI4F11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GALNT10 mouse monoclonal antibody,clone OTI2A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GALNT10 mouse monoclonal antibody,clone OTI4F11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
GALNT10 mouse monoclonal antibody,clone OTI2A12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
GALNT10 mouse monoclonal antibody,clone OTI2A12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GALNT10 mouse monoclonal antibody,clone OTI4F11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
GALNT10 mouse monoclonal antibody,clone OTI4F11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal antibody to GALNT2 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 55 and 369 of GALNT2 (Uniprot ID#Q10471) |
GALNT10 mouse monoclonal antibody,clone OTI4F11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201) |
Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Zebrafish, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2) |
Rabbit Polyclonal Anti-GCNT3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL |
GALNT10 mouse monoclonal antibody,clone OTI2A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GALNT3 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 461~490 amino acids from the Center region of human GALNT3 |