Antibodies

Jump to Filters
View as table Download
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI2A12]
TA809396

USD 447.00

In Stock

GALNT10 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI4F11]
TA809431

USD 447.00

In Stock

GALNT10 mouse monoclonal antibody,clone OTI4F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI2A12]
CF809396

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) GALNT10 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI4F11]
CF809431

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) GALNT10 mouse monoclonal antibody,clone OTI4F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GALNT2 Rabbit Polyclonal Antibody
TA308882

USD 625.00

5 Days

Rabbit Polyclonal antibody to GALNT2 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2))

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 55 and 369 of GALNT2 (Uniprot ID#Q10471)
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI4F11]
TA809431S

USD 200.00

In Stock

GALNT10 mouse monoclonal antibody,clone OTI4F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SIAT4A (ST3GAL1) Rabbit Polyclonal Antibody
TA307977

USD 625.00

2 Weeks

Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201)
GALNT7 Rabbit Polyclonal Antibody
TA309013

USD 625.00

5 Days

Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Zebrafish, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2)
GCNT3 Rabbit Polyclonal Antibody
TA332087

USD 485.00

5 Days

Rabbit Polyclonal Anti-GCNT3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI2A12]
TA809396S

USD 200.00

2 Days

GALNT10 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GALNT3 (Center) Rabbit Polyclonal Antibody
AP51768PU-N

USD 580.00

2 Weeks

GALNT3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 461~490 amino acids from the Center region of human GALNT3