Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal RARA Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This RARA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-349 amino acids from the C-terminal region of human RARA. |
Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Goat Polyclonal Antibody against AR
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EVQLGLGRVYPRPPSC, from the N Terminus of the protein sequence according to NP_000035. |
Rabbit polyclonal RARB Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | This RARB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-195 amino acids from the Central region of human RARB. |
Rabbit Polyclonal Anti-PPARG Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPARG Antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI |
Rabbit Polyclonal Anti-RARB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARB antibody: synthetic peptide directed towards the C terminal of human RARB. Synthetic peptide located within the following region: SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS |
Active filters
Reactivities
- Mouse
Isotypes
- IgG
Families
- Nuclear Hormone Receptor
Pathways
- Pathways in cancer