PPAR gamma (PPARG) Rabbit Polyclonal Antibody

CAT#: TA331938

Rabbit Polyclonal Anti-PPARG Antibody

Product Images

WB Suggested Anti-PPARG Antibody Titration: 1.25ug/ml; Positive Control: 293T cell lysate

• 

  Mouse cornea and eyelid; Primary Antibody Dilution: 1: 100; Secondary Antibody: Goat anti-rabbit-AlexaFluor-546; Secondary Antibody: ilution. 1: 1000; Color/Signal Descriptions. PPARG: Green DAPI: Red; Gene Name: Ppar Gamma Submitted by: Anonymous

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PPARG Antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: peroxisome proliferator activated receptor gamma
• Database Link:
  NP_056953
  Entrez Gene 19016 Mouse
  UniProt ID P37231
• Background: PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.
• Synonyms: CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARgamma
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Sheep: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer