Antibodies

Jump to Filters
View as table Download
HES5 Mouse Monoclonal Antibody [Clone ID: OTI6F7]
TA810555

USD 447.00

In Stock

HES5 mouse monoclonal antibody,clone OTI6F7

Applications WB
Reactivities Human
Conjugation Unconjugated
HES5 Mouse Monoclonal Antibody [Clone ID: OTI6F7]
CF810555

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) HES5 mouse monoclonal antibody,clone OTI6F7

Applications WB
Reactivities Human
Conjugation Unconjugated
HES5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F7]
TA810555BM

USD 509.00

2 Weeks

HES5 mouse monoclonal antibody,clone OTI6F7, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP
HES5 Rabbit Polyclonal Antibody
TA349126

USD 570.00

5 Days

Rabbit Polyclonal Anti-HES5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HES5 antibody was raised against a 19 amino acid peptide near the amino terminus of human HES5.
HES5 Rabbit Polyclonal Antibody
TA337146

USD 550.00

5 Days

Rabbit Polyclonal HES5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acid1-50 of human HES5 was used as the immunogen for this antibody.
HES5 Rabbit Polyclonal Antibody
TA351244

USD 380.00

In Stock

Rabbit Polyclonal Anti-HES5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HES5
HES5 Rabbit Polyclonal Antibody
TA342132

USD 539.00

5 Days

Rabbit Polyclonal Anti-HES5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HES5 antibody: synthetic peptide directed towards the middle region of human HES5. Synthetic peptide located within the following region: AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH