Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) Perforin-1 mouse monoclonal antibody, clone OTI3D7

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Perforin-1 mouse monoclonal antibody, clone OTI10A2

Applications IHC
Reactivities Human
Conjugation Unconjugated

PRF1 Rabbit Polyclonal Antibody

Applications ICC/IF, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRF1

Rabbit Polyclonal Anti-PRF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRF1 antibody: synthetic peptide directed towards the N terminal of human PRF1. Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR

Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Purified

Applications FC
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal antibody to Perforin 1 (perforin 1 (pore forming protein))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 9 and 214 of Perforin 1 (Uniprot ID#P14222)

Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Azide Free

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated