Antibodies

Jump to Filters
View as table Download
BACH1 Mouse Monoclonal Antibody [Clone ID: OTI4E11]
TA504484

USD 478.00

In Stock

BACH1 mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
BACH1 Mouse Monoclonal Antibody [Clone ID: OTI4E11]
CF504484

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) BACH1 mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
BACH1 Mouse Monoclonal Antibody [Clone ID: OTI4E11]
TA504484S

USD 200.00

2 Days

BACH1 mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

BACH1 (Isoform 1) (92-104) Rabbit Polyclonal Antibody
AP07549PU-N

USD 575.00

2 Weeks

BACH1 (Isoform 1) (92-104) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant human BACH1 , aa 92-104
BACH1 Rabbit Polyclonal Antibody
AP06634PU-N

USD 465.00

3 Weeks

BACH1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 131-180 of Human BACH1.
BACH1 Rabbit Polyclonal Antibody
TA312525

USD 380.00

4 Weeks

Rabbit polyclonal anti-BACH1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BACH1.
BACH1 (250-263) Goat Polyclonal Antibody
AP32821PU-N

USD 520.00

5 Days

BACH1 (250-263) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region (250-263) of the protein sequence according to NP_001177.1
BACH1 (C-term) Rabbit Polyclonal Antibody
AP50333PU-N

USD 580.00

2 Weeks

BACH1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 670-698 amino acids from the C-terminal region of human BACH1
BACH1 Rabbit Polyclonal Antibody
TA373910

USD 365.00

3 Weeks

BACH1 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human BACH1 (NP_996749.1).
Modifications Unmodified
BACH1 Rabbit Polyclonal Antibody
TA335183

USD 485.00

5 Days

Rabbit Polyclonal Anti-BACH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BACH1 antibody: synthetic peptide directed towards the C terminal of human BACH1. Synthetic peptide located within the following region: PPCARGNSEPGYARGQESQQMSTATSEQAGPAEQCRQSGGISDFCQQMTD
BACH1 Rabbit Polyclonal Antibody
TA363751

USD 539.00

5 Days

BACH1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BACH1