Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CD162 (SELPLG) mouse monoclonal antibody, clone TC2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
SELPLG Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SELPLG |
Rabbit Polyclonal Anti-SELPLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the C-terminal region of Human SELPLG. Synthetic peptide located within the following region: EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF |
Rabbit Polyclonal Anti-SELPLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the N-terminal region of Human SELPLG. Synthetic peptide located within the following region: GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR |
Anti-CD162 antibody(DMC283), IgG1 Chimeric mAb
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CD162
Reactivities
- Human
Conjugates
- Unconjugated