Rabbit Polyclonal HIF-2 alpha Antibody
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, SDS-PAGE, Simple Western, WB |
| Reactivities | Fish, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Neuropeptide Y / NPY rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Amphibian, Birds, Fish, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Neuropeptide Y coupled to bovine thyroglobulin (BTg) with glutaraldehyde |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila, Fish, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus, Beluga, Hamster, Guinea Pig, C. elegans |
| Conjugation | Unconjugated |
FMRF Amide (Cardio-excitatory Peptide) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Fish, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic FMRF-Amide coupled to bovine thyroglobulin (BTg) with FNPS. |
Collagen IV (COL4A1) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Feline, Fish, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human placental type IV Collagen. |
Rabbit Polyclonal Anti-OMA1 Antibody
| Applications | WB |
| Reactivities | Human, Fish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
Mouse Monoclonal anti-CNGA1 Antibody
| Applications | IHC |
| Reactivities | Fish, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Mouse monoclonal Hsp70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit fly |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
