Anti-IVD mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Anti-IVD mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IVD mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Anti-IVD mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-IVD mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IVD mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Anti-IVD mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IVD mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to IVD (isovaleryl Coenzyme A dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 222 of IVD (Uniprot ID#P26440) |
Anti-IVD mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-IVD Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IVD antibody is: synthetic peptide directed towards the N-terminal region of Human IVD. Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV |
Anti-IVD mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".