Perforin-1 mouse monoclonal antibody, clone OTI3D7
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Perforin-1 mouse monoclonal antibody, clone OTI3D7
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Perforin-1 mouse monoclonal antibody, clone OTI10A2
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Perforin-1 mouse monoclonal antibody, clone OTI3D7
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Perforin-1 mouse monoclonal antibody, clone OTI10A2
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
PRF1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRF1 |
Perforin-1 mouse monoclonal antibody, clone OTI3D7
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Perforin-1 mouse monoclonal antibody, clone OTI10A2
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-PRF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRF1 antibody: synthetic peptide directed towards the N terminal of human PRF1. Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Purified
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to Perforin 1 (perforin 1 (pore forming protein))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 9 and 214 of Perforin 1 (Uniprot ID#P14222) |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Azide Free
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |