Antibodies

View as table Download

PYCR1 mouse monoclonal antibody,clone OTI4F2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PYCR1 mouse monoclonal antibody,clone OTI4F2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PYCR1 mouse monoclonal antibody,clone OTI4F2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE

PYCR1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 290-319aa) of human PYCR1.

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR

PYCR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PYCR1