PYCR1 Rabbit Polyclonal Antibody

CAT#: TA344624

Reviews ()
Write a review

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region



USD 539.00


Availability*
5 Days

Size
    • 100 ul


Product images

Other products for "PYCR1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 33 kDa
Gene Name pyrroline-5-carboxylate reductase 1
Background This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes
Synonyms ARCL2B; ARCL3B; P5C; P5CR; PIG45; PP222; PRO3; PYCR
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Zebrafish: 86%
Reference Data
Protein Pathways Arginine and proline metabolism, Metabolic pathways
Frequently bought together (3)
Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2
    • 100 ug

USD 2,950.00


Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.