PYCR1 Rabbit Polyclonal Antibody

CAT#: TA344624

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region

Product Images

Lanes: 1. 10 ug human fibroblast lysate; 2. 10 ug PYCR1 KO human fibroblast lysate; Primary Antibody Dilution: 1:300; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1:1000; Gene Name: PYCR1; Submitted by: Anonymous;

• 

  Lanes: 1. 10 ug human fibroblast lysate; 2. 10 ug PYCR1 KO human fibroblast lysate; Primary Antibody Dilution: 1:300; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1:1000; Gene Name: PYCR1; Submitted by: Anonymous;

• 

  WB Suggested Anti-PYCR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysatePYCR1 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  PYCR1 antibody - middle region validated by WB using 293T cells lysate at 1 ug/ml.PYCR1 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: pyrroline-5-carboxylate reductase 1
• Database Link:
  NP_722546
  Entrez Gene 5831 Human
  UniProt ID P32322
• Background: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes
• Synonyms: ARCL2B; ARCL3B; P5C; P5CR; PIG45; PP222; PRO3; PYCR
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Zebrafish: 86%

Reference Data

• Protein Pathways: Arginine and proline metabolism, Metabolic pathways