Germany
Japan
United Kingdom
China
Rabbit polyclonal HNF1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Antibodies
View as table Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OR-4F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Rabbit Polyclonal Anti-OTX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
GATA6 Rabbit monoclonal antibody,clone OTIR5F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR5B8
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
GATA6 Rabbit monoclonal antibody,clone OTIR3H6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Embryonic stem cells
Filter by
Target Symbol
- SMAD3 (18)
- CD44 (14)
- C-MYC (13)
- SMAD2 (13)
- GATA6 (12)
- HNF1 BETA (12)
- SOX2 (12)
- FOXA2 (10)
- OCT4 (10)
- BDNF (9)
- CD117 (9)
- DNMT3B (8)
- FGF4 (8)
- SOX9 (8)
- KLF4 (7)
- NEUROD1 (7)
- CDX2 (6)
- GATA4 (6)
- NANOG (6)
- PAX3 (6)
- PDX1 (6)
- EGF (5)
- OTX2 (5)
- REX1 (5)
- BMP7 (4)
- IGFBP1 (4)
- IGFBP2 (4)
- PAX7 (4)
- PDGFC (4)
- PTF1A (4)
- BMP15 (3)
- BMP6 (3)
- CCN4 (3)
- CD14 (3)
- CD9 (3)
- CRIPTO1 (3)
- DPPA2 (3)
- GRB7 (3)
- BMP2 (2)
- BMP4 (2)
- BMP8B (2)
- BXDC2 (2)
- CD34 (2)
- EOMES (2)
- FGF21 (2)
- GDF7 (2)
- GLI2 (2)
- GLI3 (2)
- KGF (2)
- KLF5 (2)
- NODAL (2)
- PAX4 (2)
- PAX6 (2)
- PROX1 (2)
- TAT (2)
- BMP5 (1)
- FGF10 (1)
- GDF 5 (1)
- GDF 9 (1)
- GDF3 (1)
- HBZ (1)
- UTF1 (1)
- ZIC3 (1)
Reactivities
Applications
Antibody Hosts
Clonalities
Modifications
Assay Types
Pathways
- Pathways in cancer (79)
- TGF-beta signaling pathway (63)
- Cell cycle (44)
- Colorectal cancer (44)
- Wnt signaling pathway (44)
- MAPK signaling pathway (43)
- Maturity onset diabetes of the young (39)
- Pancreatic cancer (36)
- Hematopoietic cell lineage (33)
- Adherens junction (31)
- Chronic myeloid leukemia (31)
- Cytokine-cytokine receptor interaction (25)
- Regulation of actin cytoskeleton (25)
- Acute myeloid leukemia (24)
- Melanoma (22)
- Bladder cancer (18)
- Endometrial cancer (18)
- ErbB signaling pathway (18)
- Hedgehog signaling pathway (18)
- Endocytosis (16)
- ECM-receptor interaction (14)
- Jak-STAT signaling pathway (13)
- Small cell lung cancer (13)
- Thyroid cancer (13)
- Melanogenesis (11)
- Cysteine and methionine metabolism (10)
- Metabolic pathways (10)
- Focal adhesion (9)
- Gap junction (9)
- Huntington's disease (9)
- Neurotrophin signaling pathway (9)
- Prostate cancer (9)
- Basal cell carcinoma (8)
- Type II diabetes mellitus (6)
- Glioma (5)
- Non-small cell lung cancer (5)
- Pathogenic Escherichia coli infection (3)
- Toll-like receptor signaling pathway (3)
- Cell adhesion molecules (CAMs) (2)
- Phenylalanine (2)
- Phenylalanine metabolism (2)
- Tyrosine metabolism (2)
- Ubiquinone and other terpenoid-quinone biosynthesis (2)
- tyrosine and tryptophan biosynthesis (2)