Antibodies

View as table Download

Trypsin (PRSS3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 143-171 amino acids from the Central region of Human Trypsin-3 / PRSS3

Trypsin (PRSS3) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 20-48aa) of human Trypsin-3 / PRSS3

Rabbit polyclonal Anti-PRSS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRSS3 antibody: synthetic peptide directed towards the N terminal of human PRSS3. Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH

Trypsin (PRSS1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 81-107 aa) of human Trypsin-1 / PRSS1.

Rabbit Polyclonal Anti-PRSS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRSS1 antibody: synthetic peptide directed towards the N terminal of human PRSS1. Synthetic peptide located within the following region: LILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLIN

PRSS1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

PRSS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRSS1