Trypsin (PRSS1) Rabbit Polyclonal Antibody
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Trypsin"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PRSS1 antibody: synthetic peptide directed towards the N terminal of human PRSS1. Synthetic peptide located within the following region: LILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLIN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 24 kDa |
Gene Name | protease, serine 1 |
Database Link | |
Background | This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. |
Synonyms | TRP1; TRY1; TRY4; TRYP1 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Pig: 79%; Rabbit: 79%; Zebrafish |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.