Trypsin (PRSS1) Rabbit Polyclonal Antibody

CAT#: TA343092

Rabbit Polyclonal Anti-PRSS1 Antibody

Product Images

WB Suggested Anti-PRSS1 Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRSS1 antibody: synthetic peptide directed towards the N terminal of human PRSS1. Synthetic peptide located within the following region: LILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLIN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: protease, serine 1
• Database Link:
  NP_002760
  Entrez Gene 5644 Human
  UniProt ID P07477
• Background: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.
• Synonyms: TRP1; TRY1; TRY4; TRYP1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Pig: 79%; Rabbit: 79%; Zebrafish

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Neuroactive ligand-receptor interaction