Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Yeast, Dog, Chicken, Chimpanzee, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174) |
IDH1 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the Internal region of the protein sequence according to NP_014361.1. |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody
| Applications | Dot, WB |
| Reactivities | Human, Chicken, Drosophila, Yeast |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928] |
HXK1 rabbit polyclonal antibody, HRP
| Applications | ELISA, WB |
| Reactivities | Yeast |
| Conjugation | HRP |
| Immunogen | Hexokinase from Yeast |
RAD9A pSer1260 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to phosphorylated form of aa 1249-1263 of 1309 of yeast Rad9 protein conjugated to KLH. |
RAD9A pSer1129 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 1125-1139 of 1309 of yeast Rad9 protein conjugated to KLH. |
GND1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | 6-Phosphogluconic dehydrogenase isolated and purified from yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Germany
Japan
United Kingdom
China
