Rabbit Polyclonal Anti-PRKX Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PRKX |
Rabbit Polyclonal Anti-PRKX Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PRKX |
Rabbit Polyclonal Anti-ARHGEF11 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ARHGEF11 |
Rabbit Polyclonal Anti-KCNMB4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNMB4 |
Rabbit Polyclonal Anti-PLCB3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLCB3 |
Rabbit Polyclonal Anti-PPP1CC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PPP1CC |
USD 580.00
2 Weeks
Calcium independent Phospholipase A2 (PLA2G6) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 558-588aa) of human PLA2G6. |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Xenopus, Chicken, Bovine, Rhesus Monkey, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Anti-ADRA1B Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 500-515 amino acids of Human Alpha-1B adrenergic receptor |
Rabbit polyclonal MEK2 (MAP2K2) Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This MEK2 (MAP2K2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of human MEK2 (MAP2K2). |
Rabbit Polyclonal anti-GNAS antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD |
Rabbit Polyclonal Antibody against BRAF (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Chicken) |
Conjugation | Unconjugated |
Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Dog, Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2) |
Anti-RAMP3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 24-118 amino acids of human receptor (G protein-coupled) activity modifying protein 3 |
Anti-MYH11 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1958-1972 amino acids of Human myosin, heavy chain 11, smooth muscle |
PKC alpha (PRKCA) (pan) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 470-520 of Human PKC-pan. |