Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Rabbit polyclonal TNF Receptor-1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1. |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Anti-TNF-R1 Antibody
| Reactivities | Human, Mouse, Rat, Monkey, Bovine, Canine, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- Alzheimer's disease