Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit Polyclonal ATF6 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ATF6 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ATF6. The immunogen is located within amino acids 30 - 80 of ATF6. |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Germany
Japan
United Kingdom
China
