Antibodies

View as table Download

Rabbit Polyclonal Anti-KIT Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KIT

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

Rabbit Polyclonal Anti-BMP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

Rabbit anti-BMP7 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP7

Rabbit polyclonal anti-BMP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP2

Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703
Modifications Phospho-specific

Rabbit Polyclonal KIT Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human KIT.

Rabbit Polyclonal c-Kit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Kit

Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721.
Modifications Phospho-specific

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY

BMP7 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli.

BMP7 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli.

Rabbit anti-PDGFC polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen peptide coupled to KLH

Rabbit anti-PDGFC polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Partial recombaint protein