Rabbit Polyclonal Anti-ZNF133 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the N terminal of human ZNF133. Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL |
Rabbit Polyclonal Anti-ZNF133 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the middle region of human ZNF133. Synthetic peptide located within the following region: KPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYS |
Rabbit Polyclonal Anti-ZNF133 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the N terminal of human ZNF133. Synthetic peptide located within the following region: MAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYSNLVSLGISFSKPELI |
ZNF133 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF133 |
ZNF133 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF133 |
ZNF133 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ZNF133 (NP_003425.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
