Goat Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit polyclonal anti-GAPDH antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit polyclonal anti-GAPDH antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Bovine, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Germany
Japan
United Kingdom
China
