Rabbit Polyclonal Anti-GLUD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat (Predicted: Chimpanzee) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
USD 380.00
4 Weeks
Rabbit Polyclonal Anti-GLUD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF |
Anti-GAD2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 55-69 amino acids of Human glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) |
Rabbit polyclonal GAD2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This GAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 109-138 amino acids from the Central region of human GAD2. |
GAD67 (GAD1) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide KLH conjugated corresponding to a region near the C-terminus of this gene product, and was 100% conserved between the Human (Q99259), Mouse (P48318) and Rat (NP_058703) gene products. After repeated injections into the hens, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity purified using a peptide column. |
Germany
Japan
United Kingdom
China
