Antibodies

Jump to Filters
View as table Download
DNMT3A Rabbit Polyclonal Antibody
TA322196

USD 380.00

In Stock

Anti-DNMT3A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha
DNMT3A Rabbit Polyclonal Antibody
TA349525

USD 380.00

In Stock

Rabbit Polyclonal Anti-DNMT3A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNMT3A
DNMT3A Rabbit Polyclonal Antibody
TA301633

USD 550.00

5 Days

Rabbit Polyclonal Antibody against DNMT3a

Applications ICC/IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody was raised against amino acids 10-118 of the human DNMT3a protein.
DNMT3A Rabbit Polyclonal Antibody
TA346818

USD 539.00

5 Days

Rabbit Polyclonal Anti-DNMT3A Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE
DNMT3A Rabbit Polyclonal Antibody
TA322195

USD 380.00

4 Weeks

Anti-DNMT3A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha
DNMT3A Rabbit Polyclonal Antibody
TA347112

USD 580.00

5 Days

Rabbit Polyclonal DNMT3A Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 44-58.
DNMT3A Rabbit Polyclonal Antibody
TA347113

USD 580.00

5 Days

Rabbit Polyclonal DNMT3A Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 92-106.
DNMT3A Rabbit Polyclonal Antibody
TA347114

USD 580.00

5 Days

Rabbit Polyclonal DNMT3A Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 107-121.
DNMT3A Rabbit Polyclonal Antibody
TA327251

USD 365.00

3 Weeks

DNMT3A Rabbit Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DNMT3A
DNMT3A (Center) Rabbit Polyclonal Antibody
AP51302PU-N

USD 580.00

2 Weeks

DNMT3A (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Central region of Human DNMT3A
DNMT3A (C-term) Rabbit Polyclonal Antibody
AP51303PU-N

USD 580.00

2 Weeks

DNMT3A (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 871-900 amino acids from the C-terminal region of Human DNMT3A.