Germany
Japan
United Kingdom
China
USD 509.00
2 Weeks
Antibodies
View as table Download
GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)
| Applications | FC, IHC, WB |
| Reactivities | Human, Dog, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal anti-GTF2F2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ |
Rabbit Polyclonal anti-GTF2F2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ |
Rabbit Polyclonal anti-GTF2F2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the C terminal of human GTF2F2. Synthetic peptide located within the following region: KDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD |
GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
| Applications | FC, IF, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-GTF2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERD |
Rabbit Polyclonal Anti-GTF2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: DKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKY |
Active filters
Category
- Antibodies
Target Symbol
- TFIIF
Pathways
- Basal transcription factors