TFIIF (GTF2F1) Rabbit Polyclonal Antibody

CAT#: TA330080

Rabbit Polyclonal Anti-GTF2F1 Antibody

Product Images

WB Suggested Anti-GTF2F1 Antibody Titration: 0.2-1 ug/ml; Positive Control: K562 cell lysateThere is BioGPS gene expression data showing that GTF2F1 is expressed in K562

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: general transcription factor IIF subunit 1
• Database Link:
  NP_002087
  Entrez Gene 2962 Human
  UniProt ID P35269
• Background: GTF2F1 is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.
• Synonyms: BTF4; RAP74; TF2F1; TFIIF
• Note: Immunogen sequence homology: Dog: 100%; Guinea pig: 100%; Human: 100%; Rabbit: 100%; Mouse: 85%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Basal transcription factors