Antibodies

View as table Download

Rabbit Polyclonal Anti-GTF2I Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GTF2I

Rabbit Polyclonal Anti-TAF10 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TAF10

Rabbit polyclonal anti-TBP antibody, Loading control

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Monkey, Xenopus)
Conjugation Unconjugated
Immunogen This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP.

Rabbit Polyclonal Anti-TAF12 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TAF12

Rabbit Polyclonal Anti-TAF11 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TAF11

Rabbit Polyclonal anti-GTF2F2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ

Rabbit Polyclonal anti-GTF2F2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ

Rabbit Polyclonal Anti-GTF2H1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the N terminal of human GTF2H1. Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI

Rabbit Polyclonal Anti-TAF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the C terminal of human TAF1. Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Rabbit polyclonal anti-TF2E2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TF2E2.

Rabbit polyclonal anti-TF2H1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H1.

Rabbit polyclonal anti-TAF5 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TAF5.

Rabbit polyclonal anti-TAF1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of human TAF1.

Rabbit polyclonal GTF2I Antibody (N-term)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This GTF2I antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-310 amino acids from the N-terminal region of human GTF2I.

Goat Polyclonal Anti-TNNI3 (aa117-127) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-TNNI3 (aa117-127) Antibody: Peptide with sequence C-KVTKNITEIAD, from the internal region of the protein sequence according to NP_000354.4.