Rabbit Polyclonal Anti-WDR5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human WDR5 |
Rabbit Polyclonal Anti-WDR5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human WDR5 |
Rabbit Polyclonal Anti-WDR5 Antibody
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WDR5 antibody: synthetic peptide directed towards the C terminal of human WDR5. Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI |
Rabbit Polyclonal WDR5 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | WDR5 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human WDR5. |
Rabbit Polyclonal WDR5 Antibody
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WDR5 antibody: mouse Wdr5 (WD (tryptophan-aspartate) repeat domain protein 5), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein |
WDR5 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 11-40 amino acids from the N-terminal region of human WDR5 |
Rabbit Polyclonal WDR5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WDR5 antibody: human WDR5 (WD (tryptophan-aspartate) repeat domain 5), using a recombinant protein. |