Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-WDR5 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR5 antibody: synthetic peptide directed towards the C terminal of human WDR5. Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI |
Rabbit Polyclonal WDR5 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR5 antibody: mouse Wdr5 (WD (tryptophan-aspartate) repeat domain protein 5), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein |
WDR5 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 11-40 amino acids from the N-terminal region of human WDR5 |
Rabbit Polyclonal WDR5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR5 antibody: human WDR5 (WD (tryptophan-aspartate) repeat domain 5), using a recombinant protein. |
