Antibodies

View as table Download

Rabbit Polyclonal Anti-CYP2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19. Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD

Cytochrome p450 2C19 (CYP2C19) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Cytochrome p450 2C19 (CYP2C19) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 257-285 amino acids from the Central region of Human CYP2C19.

Rabbit Polyclonal Anti-Cytochrome P450 2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2C19 Antibody: A synthesized peptide derived from human Cytochrome P450 2C19