Rabbit Polyclonal Anti-KCTD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KCTD1 Antibody is: synthetic peptide directed towards the middle region of Human KCTD1. Synthetic peptide located within the following region: EEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSG |
Rabbit Polyclonal Anti-KCTD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KCTD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human KCTD1. Synthetic peptide located within the following region: NHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEY |
Germany
Japan
United Kingdom
China