Antibodies

View as table Download

Rabbit Polyclonal HIF-2 alpha Antibody

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, SDS-PAGE, Simple Western, WB
Reactivities Fish, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein.

EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal Antibody against HIF-2 alpha (ep190b)

Applications ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody,clone OTI6G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

HIF 2 alpha (EPAS1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 127-154 amino acids from the N-terminal region of Human HIF2A

Rabbit Polyclonal Anti-EPAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1. Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD

EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".