RFC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC1 |
RFC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC1 |
GTF2H2 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-TF2H2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H2. |
Rabbit polyclonal anti-MAT1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAT1. |
Cyclin H (CCNH) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Anti-Rfc1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Rfc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rfc1. Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG |
Rabbit Polyclonal Anti-Cyclin H Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cyclin H Antibody: A synthesized peptide derived from human Cyclin H |
Rabbit Polyclonal Anti-TF2H2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TF2H2 Antibody: A synthesized peptide derived from human TF2H2 |
Goat Polyclonal Anti-CDK7 (aa47-58) Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CDK7 (aa47-58) Antibody: Peptide with sequence C-HRSEAKDGINRT, from the internal region of the protein sequence according to NP_001790.1. |