Antibodies

Jump to Filters
View as table Download
EGF Rabbit Polyclonal Antibody
TA324064

USD 380.00

In Stock

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor
EGF Rabbit Polyclonal Antibody
TA324063

USD 380.00

In Stock

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor
EGF Rabbit Polyclonal Antibody
TA346085

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY
EGF Goat Polyclonal Antibody
TA329069

USD 520.00

5 Days

Pro-EGF Goat Polyclonal Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Internal region (near the N terminus) (SRQERVCNIEKNVS)
EGF Rabbit Polyclonal Antibody
TA347892

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF