Antibodies

Jump to Filters
View as table Download
GRPR Rabbit Polyclonal Antibody
TA316872

USD 515.00

2 Weeks

GRPR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%).
beta 2 Adrenergic Receptor (ADRB2) Rabbit Polyclonal Antibody
TA323758

USD 380.00

2 Weeks

Anti-ADRB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface
BDKRB1 Rabbit Polyclonal Antibody
TA317579

USD 515.00

In Stock

B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%).
alpha 1a Adrenergic Receptor (ADRA1A) Rabbit Polyclonal Antibody
TA308493

USD 625.00

5 Days

Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)

Applications IF, IHC, WB
Reactivities Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348)
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA321416

USD 380.00

4 Weeks

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor
HTR2C Rabbit Polyclonal Antibody
TA330447

USD 485.00

5 Days

Rabbit Polyclonal Anti-HTR2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
TA306839

USD 570.00

2 Weeks

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.
GRPR Rabbit Polyclonal Antibody
TA321704

USD 380.00

In Stock

Anti-GRPR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 350-365 amino acids of Human gastrin-releasing peptide receptor
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA341637

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
CCKBR Goat Polyclonal Antibody
TA303029

USD 520.00

5 Days

Goat Polyclonal Antibody against CCKBR

Applications IHC, WB
Reactivities Human, Rat (Expected from sequence similarity: Mouse, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-FDGDSDSDSQSRVRNQ, from the internal region of the protein sequence according to NP_795344.1.
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA321217

USD 380.00

4 Weeks

Anti-GRM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1
alpha 1b Adrenergic Receptor (ADRA1B) Rabbit Polyclonal Antibody
TA323588

USD 380.00

4 Weeks

Anti-ADRA1B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 506-520 amino acids of human adrenoceptor alpha 1B
alpha 1a Adrenergic Receptor (ADRA1A) Rabbit Polyclonal Antibody
TA323589

USD 380.00

In Stock

Anti-ADRA1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 152-165 amino acids of human adrenoceptor alpha 1A
Endothelin A Receptor (EDNRA) Rabbit Polyclonal Antibody
TA350657

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-EDNRA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EDNRA
Thromboxane A2 receptor (TBXA2R) Rabbit Polyclonal Antibody
TA351878

USD 380.00

In Stock

Rabbit Polyclonal Anti-TBXA2R Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TBXA2R