beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody

CAT#: TA341637

Rabbit Polyclonal Anti-ADRB1 Antibody

Product Images

WB Suggested Anti-ADRB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain

• 

  Host: Rabbit; Target Name: ADRB1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ADRB1; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ADRB1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ADRB1; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-ADRB1 Antibody ; Positive Control: Lane 1: 20ug Wild type mouse, left ventricle Lane 2: 20ug Transgenic mouse, treated with experimental drug, left ventricle Lane 3: 20ug HepG2 lysate; Primary Antibody Dilution : 1:1000; Secondary Antib

Show all 6 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: adrenoceptor beta 1
• Database Link:
  NP_000675
  Entrez Gene 11554 MouseEntrez Gene 153 Human
  UniProt ID P08588
• Background: The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediateThe physiological effects ofThe hormone epinephrine andThe neurotransmitter norepinephrine. Specific polymorphisms inThis gene have been shown to affectThe resting heart rate and can be involved in heart failure. [provided by RefSeq, Jul 2008]
• Synonyms: ADRB1R; B1AR; BETA1AR; RHR
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Guinea pig: 93%; Dog: 87%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Calcium signaling pathway, Dilated cardiomyopathy, Endocytosis, Gap junction, Neuroactive ligand-receptor interaction