Antibodies

Jump to Filters
View as table Download
Angiotensin II Type 2 Receptor (AGTR2) Rabbit Polyclonal Antibody
TA306840

USD 570.00

5 Days

Rabbit Polyclonal AGTR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR2 antibody was raised against a 16 amino acid peptide from near the center of human AGTR2.
Angiotensin II Type 2 Receptor (AGTR2) Rabbit Polyclonal Antibody
TA342805

USD 539.00

5 Days

Rabbit Polyclonal Anti-AGTR2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AGTR2 antibody: synthetic peptide directed towards the N terminal of human AGTR2. Synthetic peptide located within the following region: LHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVT