Angiotensin II Type 2 Receptor (AGTR2) Rabbit Polyclonal Antibody

CAT#: TA342805

Rabbit Polyclonal Anti-AGTR2 Antibody

Product Images

AGTR2 antibody validated by WB using Mouse brain membranes at 1:4,000.

• 

  AGTR2 antibody validated by WB using Fetal Heart at 0.2-1 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AGTR2 antibody: synthetic peptide directed towards the N terminal of human AGTR2. Synthetic peptide located within the following region: LHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: angiotensin II receptor type 2
• Database Link:
  NP_000677
  Entrez Gene 11609 MouseEntrez Gene 186 Human
  UniProt ID P50052
• Background: The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation.
• Synonyms: AT2; ATGR2; MRX88
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Horse: 79%; Mouse: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction, Renin-angiotensin system