Antibodies

View as table Download

PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-Patched1 (Patched) mouse monoclonal antibody, clone OTI3c2 (formerly 3c2), HRP conjugated

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Goat Polyclonal Antibody against PTCH

Applications IF, WB
Reactivities Human, Mouse (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-HPESRHHPPSNPRQQ, from the internal region of the protein sequence according to NP_000255.1.

Rabbit Polyclonal Anti-PTCH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTCH1 antibody: synthetic peptide directed towards the C terminal of human PTCH1. Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM

Rabbit Polyclonal Anti-Patched Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Patched Antibody: A synthesized peptide derived from human Patched