USD 509.00
2 Weeks
PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PTCH1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PTCH1 mouse monoclonal antibody, clone OTI6C10 (formerly 6C10), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
Anti-Patched1 (Patched) mouse monoclonal antibody, clone OTI3c2 (formerly 3c2), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-Patched1 (Patched) mouse monoclonal antibody, clone OTI3c2 (formerly 3c2), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Goat Polyclonal Antibody against PTCH
Applications | IF, WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HPESRHHPPSNPRQQ, from the internal region of the protein sequence according to NP_000255.1. |
Rabbit Polyclonal Anti-PTCH1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTCH1 antibody: synthetic peptide directed towards the C terminal of human PTCH1. Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM |
Rabbit Polyclonal Anti-Patched Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Patched Antibody: A synthesized peptide derived from human Patched |
PTCH1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PTCH1 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".