Rabbit polyclonal FBXW11 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This FBXW11 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-196 amino acids from the Central region of human FBXW11. |
Rabbit polyclonal Beta TrCP2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Chicken, Bovine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminal of human βTrCP2 protein. |
Rabbit Polyclonal Anti-FBXW11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXW11 antibody: synthetic peptide directed towards the N terminal of human FBXW11. Synthetic peptide located within the following region: EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRP |
Germany
Japan
United Kingdom
China
